| Bioactivity | Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice[1]. |
| Name | Big endothelin-1 (rat 1-39) |
| CAS | 135842-15-8 |
| Sequence | Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser |
| Shortening | CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS |
| Formula | C192H296N50O58S5 |
| Molar Mass | 4393.03 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hoffman A, et al. Opposite effects of endothelin-1 and Big-endothelin-(1-39) on renal function in rats. Eur J Pharmacol. 1990 Jul 17;182(3):603-6. |
Big endothelin-1 (rat 1-39)
CAS: 135842-15-8 F: C192H296N50O58S5 W: 4393.03
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic respo
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.