PeptideDB

Big Endothelin-2 (human)

CAS: 151853-67-7 F: C194H281N49O57S4 W: 4339.86

Big Endothelin-2 (human), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Big Endothelin-2 (human), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1].
Name Big Endothelin-2 (human)
CAS 151853-67-7
Sequence Cys-Ser-Cys-Ser-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Gln-Thr-Ala-Pro-Tyr-Gly-Leu-Gly-Asn-Pro-Pro-Arg (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)
Shortening CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPR (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)
Formula C194H281N49O57S4
Molar Mass 4339.86
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.