| Bioactivity | Big Endothelin-2 (human), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1]. |
| Name | Big Endothelin-2 (human) |
| CAS | 151853-67-7 |
| Sequence | Cys-Ser-Cys-Ser-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Gln-Thr-Ala-Pro-Tyr-Gly-Leu-Gly-Asn-Pro-Pro-Arg (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Shortening | CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPR (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Formula | C194H281N49O57S4 |
| Molar Mass | 4339.86 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
Big Endothelin-2 (human)
CAS: 151853-67-7 F: C194H281N49O57S4 W: 4339.86
Big Endothelin-2 (human), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.