PeptideDB

Big Endothelin-1 (rat)

CAS: 2243219-82-9 F: C192H292N50O58S5 W: 4389.00

Big Endothelin-1 (rat) is a biologically active peptide.
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Big Endothelin-1 (rat) is a biologically active peptide.
Name Big Endothelin-1 (rat)
CAS 2243219-82-9
Sequence Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser (Disulfide bridge: Cys1-Cys15,Cys3-Cys11)
Shortening CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS (Disulfide bridge: Cys1-Cys15,Cys3-Cys11)
Formula C192H292N50O58S5
Molar Mass 4389.00
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.