PeptideDB

Beta-defensin 103 isoform X1, pig TFA

CAS: F: C348H576N105F3O85S8 W: 7904.56

Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the f
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens[1].
Name Beta-defensin 103 isoform X1, pig TFA
Sequence Met-Arg-Ile-His-Tyr-Leu-Leu-Phe-Ala-Leu-Leu-Phe-Leu-Phe-Leu-Met-Pro-Leu-Pro-Gly-Asn-Gly-Arg-Ile-Ile-Asn-Thr-Leu-Gln-Arg-Tyr-Tyr-Cys-Lys-Ile-Arg-Arg-Gly-Arg-Cys-Ala-Val-Leu-Gly-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Ser-Cys-Ser-Val-Ser-Gly-Arg-Lys-Cys-Cys-Arg-Lys-Arg-Lys
Shortening MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK
Formula C348H576N105F3O85S8
Molar Mass 7904.56
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Justyna Jarczak, et al. Defensins: Natural Component of Human Innate Immunity. Hum Immunol. 2013 Sep;74(9):1069-79.