| Bioactivity | Beta-defensin 1, pig is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig is active against bacteria such as Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis and Candida albicans[1][2]. |
| Invitro | Expression of beta-defensin (pBD-1) mRNA increased from the proximal to the distal part of the intestine whereas pBD-2 expression decreased. The main gene expression sites for pBD-2 are kidney and liver, whereas pBD-1 is mainly expressed in tongue[1]. An eight-fold increase in pBD-1 mRNA expression is observed upon S. typhimurium infection in the porcine intestinal cell line IPEC J2[1]. Porcine beta-defensin 1 (pBD-1) also has immunomodulatory activity in porcine peripheral blood mononuclear cells and lymph node cells[3]. |
| Name | Beta-defensin 1, pig |
| Sequence | Met-Arg-Ala-Leu-Cys-Leu-Leu-Leu-Leu-Thr-Val-Cys-Leu-Leu-Ser-Ser-Gln-Leu-Ala-Ala-Gly-Ile-Asn-Leu-Leu-Thr-Gly-Leu-Gly-Gln-Arg-Ser-Asp-His-Tyr-Ile-Cys-Ala-Lys-Lys-Gly-Gly-Thr-Cys-Asn-Phe-Ser-Pro-Cys-Pro-Leu-Phe-Asn-Arg-Ile-Glu-Gly-Thr-Cys-Tyr-Ser-Gly-Lys-Ala-Lys-Cys-Cys-Ile-Arg |
| Shortening | MRALCLLLLTVCLLSSQLAAGINLLTGLGQRSDHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR |
| Formula | C321H534N92O90S9 |
| Molar Mass | 7410.90 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |