| Bioactivity | Beinaglutide is a recombinant human GLP-1 (rhGLP-1) polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH)[1][2]. | ||||||
| Invitro | Beinaglutide (100 nM; 48 h) increases the expression of phosphorylation of Akt in the adipocytes that were potentiated insulin-stimulated[2]. Western Blot Analysis[2] Cell Line: | ||||||
| Name | Beinaglutide | ||||||
| CAS | 123475-27-4 | ||||||
| Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR | ||||||
| Formula | C149H225N39O46 | ||||||
| Molar Mass | 3298.61 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Beinaglutide
CAS: 123475-27-4 F: C149H225N39O46 W: 3298.61
Beinaglutide is a recombinant human GLP-1 (rhGLP-1) polypeptide that shares almost 100% homology with human GLP-1 (7–36
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.