| Bioactivity | Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes[1]. |
| Name | Bay 55-9837 |
| CAS | 463930-25-8 |
| Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2 |
| Shortening | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2 |
| Formula | C148H239ClN44O42 |
| Molar Mass | 3342.20 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |