PeptideDB

BRC4 peptide

CAS: F: C178H296N48O53 W: 3956.54

BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence[1].
Sequence Lys-Glu-Pro-Thr-Leu-Leu-Gly-Phe-His-Thr-Ala-Ser-Gly-Lys-Lys-Val-Lys-Ile-Ala-Lys-Glu-Ser-Leu-Asp-Lys-Val-Lys-Asn-Leu-Phe-Asp-Glu-Lys-Glu-Gln-NH2
Shortening KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-NH2
Formula C178H296N48O53
Molar Mass 3956.54
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Gonzalez-Hormazabal P, et al. Spectrum of BRCA1/2 point mutations and genomic rearrangements in high-risk breast/ovarian cancer Chilean families[J]. Breast cancer research and treatment, 2011, 126: 705-716.