| Bioactivity | BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence[1]. |
| Sequence | Lys-Glu-Pro-Thr-Leu-Leu-Gly-Phe-His-Thr-Ala-Ser-Gly-Lys-Lys-Val-Lys-Ile-Ala-Lys-Glu-Ser-Leu-Asp-Lys-Val-Lys-Asn-Leu-Phe-Asp-Glu-Lys-Glu-Gln-NH2 |
| Shortening | KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-NH2 |
| Formula | C178H296N48O53 |
| Molar Mass | 3956.54 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Gonzalez-Hormazabal P, et al. Spectrum of BRCA1/2 point mutations and genomic rearrangements in high-risk breast/ovarian cancer Chilean families[J]. Breast cancer research and treatment, 2011, 126: 705-716. |