| Bioactivity | BDS-II is a peptide toxin, and is composed of 43 amino acids. BDS-II is a selective Kv3.4 channel inhibitor[1]. |
| Name | BDS-II |
| Sequence | Ala-Ala-Pro-Cys-Phe-Cys-Pro-Gly-Lys-Pro-Asp-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His (Disulfide bridge:Cys4-Cys39;Cys6-Cys32;Cys22-Cys40) |
| Shortening | AAPCFCPGKPDRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Disulfide bridge:Cys4-Cys39;Cys6-Cys32;Cys22-Cys40) |
| Formula | C214H301N57O57S6 |
| Molar Mass | 4776.42 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. S Diochot, et al. Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel Kv3.4. J Biol Chem. 1998 Mar 20;273(12):6744-9. |