| Bioactivity | B7-33 is a single-chain relaxin mimetic. B7-33 is a selective relaxin receptor 1 (RXFP1) agonist. B7-33 binds to RXFP1 and preferentially activates thepERK pathway over cAMP in cells (with RXFP1 expression). B7-33 is an anti-fibrotic agent. B7-33 has cardioprotective effects[1][2]. |
| CAS | 1818415-56-3 |
| Sequence | Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH2 |
| Shortening | VIKLSGRELVRAQIAISGMSTWSKRSL-NH2 |
| Formula | C131H229N41O36S |
| Molar Mass | 2986.54 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Alam F, et al. The single-chain relaxin mimetic, B7-33, maintains the cardioprotective effects of relaxin and more rapidly reduces left ventricular fibrosis compared to perindopril in an experimental model of cardiomyopathy. Biomed Pharmacother. 2023 Apr;160:114370. [2]. Hossain MA, et al. A single-chain derivative of the relaxin hormone is a functionally selective agonist of the G protein-coupled receptor, RXFP1. Chem Sci. 2016 Jun 1;7(6):3805-3819. |
B7-33
CAS: 1818415-56-3 F: C131H229N41O36S W: 2986.54
B7-33 is a single-chain relaxin mimetic. B7-33 is a selective relaxin receptor 1 (RXFP1) agonist. B7-33 binds to RXFP1 a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.