| Bioactivity | Aviptadil is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al[1][2]. | ||||||
| Name | Aviptadil | ||||||
| CAS | 40077-57-4 | ||||||
| Shortening | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 | ||||||
| Formula | C147H238N44O42S | ||||||
| Molar Mass | 3325.80 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Aviptadil
CAS: 40077-57-4 F: C147H238N44O42S W: 3325.80
Aviptadil is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil induces pulmo
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.