| Bioactivity | Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al[1]. | ||||||
| Invitro | Aviptadil acetate (1 nM-10 μM) produces a concentration-dependent inhibition of CSE-induced cell death in L2 cells. At 10 μM, Aviptadil acetate reduces CSE-stimulated MMP activity and caspase-3 activation in L2 cells[1]. | ||||||
| Name | Aviptadil acetate | ||||||
| CAS | 1444827-29-5 | ||||||
| Shortening | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 | ||||||
| Formula | C147H238N44O42S.C2H4O2 | ||||||
| Molar Mass | 3385.90 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |