| Bioactivity | Avexitide (Exendin (9-39)) is a specific and competitive GLP-1 receptor antagonist. | ||||||
| Invitro | GLP-1 plays a role in the control of fasting glucose. Avexitide (Exendin (9-39)), a truncated form of the GLP-1 agonist exendin-4, is a specific GLP-1 receptor antagonist[1]. | ||||||
| Name | Avexitide | ||||||
| CAS | 133514-43-9 | ||||||
| Sequence | Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 | ||||||
| Shortening | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 | ||||||
| Formula | C149H234N40O47S | ||||||
| Molar Mass | 3369.76 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |