Apo A-I mimetic 5A peptide_product_DataBase

Bioactivity	Apo A-I mimetic 5A peptide is a synthetic peptide molecule designed based on the structure and function of naturally occurring apolipoprotein A-I (Apo A-I). Apo A-I mimetic 5A peptide can promote the efflux of cholesterol from cells and help reduce the accumulation of cholesterol in cells. Apo A-I mimetic 5A peptide also shows anti-inflammatory activity and can reduce inflammatory markers in blood and tissues. Apo A-I mimetic 5A peptide can be used in the study of cardiovascular diseases[1].
Sequence	Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp-Trp-Ala-Lys-Ala-Ala-Tyr-Asp-Lys-Ala-Ala-Glu-Lys-Ala-Lys-Glu-Ala-Ala
Shortening	DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA
Formula	C197H295N47O56
Molar Mass	4217.73
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Liu X, et al. Serum apolipoprotein AI depletion is causative to silica nanoparticles–induced cardiovascular damage[J]. Proceedings of the National Academy of Sciences, 2021, 118(44): e2108131118.

PeptideDB