PeptideDB

Apo A-I mimetic 5A peptide

CAS: F: C197H295N47O56 W: 4217.73

Apo A-I mimetic 5A peptide is a synthetic peptide molecule designed based on the structure and function of naturally occ
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Apo A-I mimetic 5A peptide is a synthetic peptide molecule designed based on the structure and function of naturally occurring apolipoprotein A-I (Apo A-I). Apo A-I mimetic 5A peptide can promote the efflux of cholesterol from cells and help reduce the accumulation of cholesterol in cells. Apo A-I mimetic 5A peptide also shows anti-inflammatory activity and can reduce inflammatory markers in blood and tissues. Apo A-I mimetic 5A peptide can be used in the study of cardiovascular diseases[1].
Sequence Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp-Trp-Ala-Lys-Ala-Ala-Tyr-Asp-Lys-Ala-Ala-Glu-Lys-Ala-Lys-Glu-Ala-Ala
Shortening DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA
Formula C197H295N47O56
Molar Mass 4217.73
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Liu X, et al. Serum apolipoprotein AI depletion is causative to silica nanoparticles–induced cardiovascular damage[J]. Proceedings of the National Academy of Sciences, 2021, 118(44): e2108131118.