| Bioactivity | Apelin-36(rat, mouse) TFA is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-36(rat, mouse) TFA binds to APJ receptors with an IC50 of 5.4 nM, and potently inhibits cAMP production with an EC50 of 0.52 nM. Apelin-36(rat, mouse) TFA blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ[1][2]. |
| Name | Apelin-36(rat, mouse) TFA |
| Sequence | Leu-Val-Lys-Pro-Arg-Thr-Ser-Arg-Thr-Gly-Pro-Gly-Ala-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe |
| Shortening | LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF |
| Formula | C187H305F3N68O45S |
| Molar Mass | 4314.91 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Apelin-36(rat, mouse) TFA
CAS: F: C187H305F3N68O45S W: 4314.91
Apelin-36(rat, mouse) TFA is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-36(rat, mouse) TFA bind
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.