| Bioactivity | Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3][4]. | ||||||
| Name | Apelin-36(human) | ||||||
| CAS | 252642-12-9 | ||||||
| Sequence | Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe | ||||||
| Shortening | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
| Formula | C184H297N69O43S | ||||||
| Molar Mass | 4195.83 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Apelin-36(human)
CAS: 252642-12-9 F: C184H297N69O43S W: 4195.83
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human)
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.