| Bioactivity | Anthopleurin-C (APE 2-1) is a cardiotonic polypeptide that shows a powerful positive inotropic effect[1]. |
| Name | Anthopleurin-C |
| Sequence | Gly-Val-Pro-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Ile-Leu-Trp-Leu-Ala-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bridge:Cys4-Cys44;Cys6-Cys34;Cys27-Cys45) |
| Shortening | GVPCLCDSDGPSVRGNTLSGILWLAGCPSGWHNCKAHGPTIGWCCKQ (Disulfide bridge:Cys4-Cys44;Cys6-Cys34;Cys27-Cys45) |
| Formula | C210H316N62O61S6 |
| Molar Mass | 4877.52 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. T Bruhn, et al. Isolation and characterisation of five neurotoxic and cardiotoxic polypeptides from the sea anemone Anthopleura elegantissima. Toxicon. 2001 May;39(5):693-702. |