| Bioactivity | Anpocogin is the Ancyclostoma canium nematode anticoagulant protein c2, variant (C-terminal P85 added). Anpocogin, produced in Pichia pastoris, serves as an anticoagulant agent[1]. |
| Name | Anpocogin |
| CAS | 2725767-44-0 |
| Sequence | Lys-Ala-Thr-Met-Gln-Cys-Gly-Glu-Asn-Glu-Lys-Tyr-Asp-Ser-Cys-Gly-Ser-Lys-Glu-Cys-Asp-Lys-Lys-Cys-Lys-Tyr-Asp-Gly-Val-Glu-Glu-Glu-Asp-Asp-Glu-Glu-Pro-Asn-Val-Pro-Cys-Leu-Val-Arg-Val-Cys-His-Gln-Asp-Cys-Val-Cys-Glu-Glu-Gly-Phe-Tyr-Arg-Asn-Lys-Asp-Asp-Lys-Cys-Val-Ser-Ala-Glu-Asp-Cys-Glu-Leu-Asp-Asn-Met-Asp-Phe-Ile-Tyr-Pro-Gly-Thr-Arg-Asn-Pro |
| Shortening | KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP |
| Formula | C401H617N111O1148S12 |
| Molar Mass | 9745.62 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Anpocogin
CAS: 2725767-44-0 F: C401H617N111O1148S12 W: 9745.62
Anpocogin is the Ancyclostoma canium nematode anticoagulant protein c2, variant (C-terminal P85 added). Anpocogin, produ
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.