| Bioactivity | Andropin is a male-specific antibacterial peptide that can be found in Drosophila melanogaster[1]. |
| Name | Andropin |
| Sequence | Val-Phe-Ile-Asp-Ile-Leu-Asp-Lys-Val-Glu-Asn-Ala-Ile-His-Asn-Ala-Ala-Gln-Val-Gly-Ile-Gly-Phe-Ala-Lys-Pro-Phe-Glu-Lys-Leu-Ile-Asn-Pro-Lys |
| Shortening | VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK |
| Formula | C175H278N44O47 |
| Molar Mass | 3750.35 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Samakovlis C, et, al. The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster. EMBO J. 1991 Jan;10(1):163-9. |