Amyloid β-Protein (3-42)

CAS: 157884-74-7 F: C196H301N53O56S W: 4327.87

Amyloid β-Protein (3-42) is the precursor of Pyr peptide. Pyroglutamate-modified Aβ (pEAβ) (3-42) is the core of the

Contact QiTai

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Amyloid β-Protein (3-42) is the precursor of Pyr peptide. Pyroglutamate-modified Aβ (pEAβ) (3-42) is the core of the amyloid template block in Alzheimer's disease. pEAβ(3-42) accelerated the aggregation of Aβ(1-42), while Aβ(1-42) significantly slowed the primary and secondary nucleation of pEAβ(3-42)[1].
Name	Amyloid β-Protein (3-42)
CAS	157884-74-7
Sequence	Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
Shortening	EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Formula	C196H301N53O56S
Molar Mass	4327.87
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.