| Bioactivity | Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion[1]. |
| Invitro | Amylin (IAPP), feline can aggregate into pancreatic islet amyloid deposits[1].Amylin (IAPP), feline is expressed in the gastrointestinal tract of cats[1]. |
| Name | Amylin (IAPP), feline |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) |
| Shortening | KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) |
| Formula | C165H270N52O54S2 |
| Molar Mass | 3910.45 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Amylin (IAPP), feline
CAS: F: C165H270N52O54S2 W: 3910.45
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory pr
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.