PeptideDB

Amylin (IAPP), feline TFA

CAS: F: C167H271F3N52O56S2 W: 4024.47

Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secr
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion[1].
Invitro Amylin (IAPP), feline TFA can aggregate into pancreatic islet amyloid deposits[1].Amylin (IAPP), feline TFA is expressed in the gastrointestinal tract of cats[1].
Name Amylin (IAPP), feline TFA
Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7)
Shortening KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
Formula C167H271F3N52O56S2
Molar Mass 4024.47
Appearance Solid
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Reference [1]. Westermark P, et al. Islet amyloid polypeptide, islet amyloid, and diabetes mellitus. Physiol Rev. 2011 Jul;91(3):795-826.