| Bioactivity | Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion[1]. | ||||||
| Invitro | Amylin (IAPP), feline TFA can aggregate into pancreatic islet amyloid deposits[1].Amylin (IAPP), feline TFA is expressed in the gastrointestinal tract of cats[1]. | ||||||
| Name | Amylin (IAPP), feline TFA | ||||||
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) | ||||||
| Shortening | KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) | ||||||
| Formula | C167H271F3N52O56S2 | ||||||
| Molar Mass | 4024.47 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Westermark P, et al. Islet amyloid polypeptide, islet amyloid, and diabetes mellitus. Physiol Rev. 2011 Jul;91(3):795-826. |
Amylin (IAPP), feline TFA
CAS: F: C167H271F3N52O56S2 W: 4024.47
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secr
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.