| Bioactivity | Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor. | ||||||
| Invitro | Amylin is an important, but poorly understood, 37 amino acid glucoregulatory hormone with great potential to target metabolic diseases. Amylin is a member of the calcitonin (CT) family of peptides, which includes CT itself, the CGRPs comprising two variants (αCGRP and βCGRP), adrenomedullin (AM) and AM2 (intermedin). Amylin is a centrally acting, neuroendocrine hormone synthesized with insulin in the beta cells of pancreatic islets. Amylin regulates glucose homeostasis by inhibiting gastric emptying, inhibiting the release of the counter-regulatory hormone glucagon and inducing meal-ending satiety. Amylin functions as a glucoregulatory and satiety-inducing hormone, which is protective against postprandial spikes in blood glucose and overeating.[1] | ||||||
| Name | Amylin, amide, rat | ||||||
| CAS | 124447-81-0 | ||||||
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) | ||||||
| Shortening | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) | ||||||
| Formula | C167H272N52O53S2 | ||||||
| Molar Mass | 3920.44 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Amylin, amide, rat
CAS: 124447-81-0 F: C167H272N52O53S2 W: 3920.44
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.