PeptideDB

AmmTX3 TFA

CAS: F: C158H262N50O48S6.xC2HF3O2 W: 3822.47 (free acid)

AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA i
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K+ current (Ki: 131 nM)[1][2].
Name AmmTX3 TFA
Sequence {Glp}-Ile-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Lys-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bonds: Cys8-Cys28, Cys13-Cys33, Cys17-Cys35) (TFA salt)
Shortening {Glp}-IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Disulfide bonds: Cys8-Cys28, Cys13-Cys33, Cys17-Cys35) (TFA salt)
Formula C158H262N50O48S6.xC2HF3O2
Molar Mass 3822.47 (free acid)
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Vacher H, et al. Expanding the scorpion toxin alpha-KTX 15 family with AmmTX3 from Androctonus mauretanicus. Eur J Biochem. 2002 Dec;269(24):6037-41. https:// [2]. Maffie JK, et al. Dipeptidyl-peptidase-like-proteins confer high sensitivity to the scorpion toxin AmmTX3 to Kv4-mediated A-type K+ channels. J Physiol. 2013 May 15;591(10):2419-27.