| Bioactivity | Albiglutide, a glucagon-like peptide-1 (GLP-1) mimetic, is a long-acting GLP-1 receptor agonist. Albiglutide significantly reduces glycosylated hemoglobin (A1C). Albiglutide can be used for type 2 diabetes (T2D) research. Albiglutide is generated by the genetic fusion of a DPP-4-resistant GLP-1 dimer to human albumin[1][2][3]. |
| Name | Albiglutide |
| CAS | 782500-75-8 |
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Shortening | HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Formula | C148H224N40O45 |
| Molar Mass | 3283.60 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Albiglutide
CAS: 782500-75-8 F: C148H224N40O45 W: 3283.60
Albiglutide, a glucagon-like peptide-1 (GLP-1) mimetic, is a long-acting GLP-1 receptor agonist. Albiglutide significant
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.