PeptideDB

Adrenomedullin (AM) (22-52), human

CAS: 159899-65-7 F: C159H252N46O48 W: 3576.04

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor ant
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2].
Invitro Adrenomedullin (AM) (22-52), human shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells[1].
Name Adrenomedullin (AM) (22-52), human
CAS 159899-65-7
Sequence Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Shortening TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Formula C159H252N46O48
Molar Mass 3576.04
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)