| Bioactivity | Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1]. |
| Invitro | Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells[1]. |
| Name | Adrenomedullin (AM) (22-52), human TFA |
| Sequence | Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
| Shortening | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
| Formula | C161H253N46F3O50 |
| Molar Mass | 3690.06 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Adrenomedullin (AM) (22-52), human TFA
CAS: F: C161H253N46F3O50 W: 3690.06
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue,
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.