PeptideDB

Adrenomedullin (AM) (1-52), human TFA

CAS: F: C266H407F3N80O79S3 W: 6142.76

Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.
Invitro To explore the effect of Adrenomedullin (AM) (1-52), human on astroglioma cells, CRT-MG cells are incubated in the absence or presence of Adrenomedullin (AM) (1-52), human (ADM1-52) for 48 h in a medium containing 1% FBS, and wound-healing assay is performed. The number of cells migrating to the wound region significantly increases in the ADM1-52-treated cells, in a dose-dependent manner, compared to the untreated cells[1].
Name Adrenomedullin (AM) (1-52), human TFA
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21)
Shortening YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)
Formula C266H407F3N80O79S3
Molar Mass 6142.76
Appearance Solid
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Reference [1]. Lim SY, et al. Transcriptional regulation of adrenomedullin by oncostatin M in human astroglioma cells: implications for tumor invasion and migration. Sci Rep. 2014 Sep 23;4:6444.