| Bioactivity | Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors[1]. |
| Name | Adrenomedullin (11-50), rat |
| CAS | 163648-32-6 |
| Sequence | Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge: Cys4-Cys9) |
| Shortening | STGCRFGTCTMQKLAHQIYQFTDKDKDGMAP RNKISPQGY-NH2(Disulfide bridge: Cys4-Cys9) |
| Formula | C194H304N58O59S4 |
| Molar Mass | 4521.17 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Adrenomedullin (11-50), rat
CAS: 163648-32-6 F: C194H304N58O59S4 W: 4521.17
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selec
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.