PeptideDB

Adrenocorticotropic Hormone (ACTH) (1-39), human

CAS: 12279-41-3 F: C207H308N56O58S W: 4541.14

Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.
Invitro Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH 1-39), a member of the melanocortin family, stimulates production of CS by the adrenals, but melanocortin receptors are also found in the central nervous system (CNS) and on immune cells. ACTH 1-39 protects neurons in vitro from several apoptotic, excitotoxic and inflammation-related insults[1]. The conditioned medium (CM) is prepared from untreated astroglia (AS) cultures and from AS cultures treated with 200 nM ACTH 1-39 for 24 h, washed to remove ACTH 1-39, then incubated for another 24 h in DMEM. In initial experiments, no difference is found in oligodendroglia (OL) viability in the presence of OL definedmediumwith 2% newborn calf serum (NCS) or AS CM (prepared in DMEM with no serum). After 24 h, OL death under each condition varies between 1 and 4%. Similar results for OL viability are obtained with microglia (MG) CM. In subsequent experiments, controls in each experiment consist of OL in defined medium with 2% NCS[2].
Name Adrenocorticotropic Hormone (ACTH) (1-39), human
CAS 12279-41-3
Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Shortening SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Formula C207H308N56O58S
Molar Mass 4541.14
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)