| Bioactivity | AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia[1]. |
| Name | AdTx1 |
| Sequence | Leu-Thr-Cys-Val-Thr-Ser-Lys-Ser-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asp-Cys-Pro-Asp-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Arg-His-Tyr-Val-Val-Pro-Lys-Ile-Tyr-Asp-Ser-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ile-Pro-Glu-Asn-Tyr-Asp-Ser-Ile-His-Cys-Cys-Lys-Thr-Asp-Lys-Cys-Asn-Glu (Disulfide bonds:Cys3-Cys4, Cys17-Cys42, Cys46-Cys57, Cys58-Cys63) |
| Shortening | LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSI-HCCKTDKCNE (Disulfide bonds:Cys3-Cys4, Cys17-Cys42, Cys46-Cys57, Cys58-Cys63) |
| Formula | C310H481N87O100S8 |
| Molar Mass | 7283.18 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Quinton L, et al. Isolation and pharmacological characterization of AdTx1, a natural peptide displaying specific insurmountable antagonism of the alpha1A-adrenoceptor. Br J Pharmacol. 2010 Jan 1;159(2):316-25. |