| Bioactivity | Aah II is a sodium channel modulator. Aah II is a toxin that can be isolated from the venom of scorpion Androctonus australis[1][2]. |
| Name | Aah II |
| Sequence | Val-Lys-Asp-Gly-Tyr-Ile-Val-Asp-Asp-Val-Asn-Cys-Thr-Tyr-Phe-Cys-Gly-Arg-Asn-Ala-Tyr-Cys-Asn-Glu-Glu-Cys-Thr-Lys-Leu-Lys-Gly-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Ala-Ser-Pro-Tyr-Gly-Asn-Ala-Cys-Tyr-Cys-Tyr-Lys-Leu-Pro-Asp-His-Val-Arg-Thr-Lys-Gly-Pro-Gly-Arg-Cys-His-NH2 (Disulfide bridge:Cys12-Cys63, Cys16-Cys36, Cys22-Cys46, Cys26-Cys48) |
| Shortening | VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH-NH2 (Disulfide bridge:Cys12-Cys63, Cys16-Cys36, Cys22-Cys46, Cys26-Cys48) |
| Formula | C313H457N89O95S8 |
| Molar Mass | 7243.04 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Duval A, et al. Changes in Na channel properties of frog and rat skeletal muscles induced by the AaH II toxin from the scorpion Androctonus australis. Pflugers Arch. 1989 Dec;415(3):361-71. [2]. Legros C, et al. Expression of the standard scorpion alpha-toxin AaH II and AaH II mutants leading to the identification of some key bioactive elements. Biochim Biophys Acta. 2005 May 25;1723(1-3):91-9. |