| Bioactivity | Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases[1]. |
| Name | Aa1 toxin |
| Sequence | Gln-Asn-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Arg-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bridge: Cys8-Cys28; Cys13-Cys33; Cys17-Cys35) |
| Shortening | QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP (Disulfide bridge: Cys8-Cys28; Cys13-Cys33; Cys17-Cys35) |
| Formula | C156H260N54O49S6 |
| Molar Mass | 3868.46 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Pisciotta M, et al. Fast K(+) currents from cerebellum granular cells are completely blocked by a peptide purified from Androctonus australis Garzoni scorpion venom. Biochim Biophys Acta. 2000 Sep 29;1468(1-2):203-12. |