| Bioactivity | ASB20123 is a CNP/ghrelin chimeric peptide. ASB20123 stimulate bone growth. ASB20123 can be used in research of growth disorders and dwarfism[1]. |
| Name | ASB20123 |
| Sequence | Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Val-Gln-Gln-Arg-Lys-Asp-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg (Disulfide bridge: Cys6-Cys22) |
| Shortening | GLSKGCFGLKLDRIGSMSGLGCVQQRKDSKKPPAKLQPR (Disulfide bridge: Cys6-Cys22) |
| Formula | C180H309N57O51S3 |
| Molar Mass | 4183.93 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Morozumi N, et, al. ASB20123: A novel C-type natriuretic peptide derivative for treatment of growth failure and dwarfism. PLoS One. 2019 Feb 22;14(2):e0212680. |