| Bioactivity | APP669-711 is a peptide segment from amino acid 669 to amino acid 711 of amyloid precursor protein (APP). APP669-711 can be used to diagnose the amyloid deposition in the brain, and is a biomarker for Alzheimer's disease (AD) research[1]. |
| Sequence | Val-Lys-Met-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Shortening | VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Formula | C210H325N57O61S2 |
| Molar Mass | 4688.30 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Klafki HW, et al., Detection and quantification of Aβ-3-40 (APP669-711) in cerebrospinal fluid. J Neurochem. 2022 Mar;160(5):578-589. |