PeptideDB

AH-D peptide

CAS: F: C154H228N38O40S W: 3283.75

AH-D peptide is an antiviral peptide that selectively disrupts membrane structures within the size range of exosomes, in
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity AH-D peptide is an antiviral peptide that selectively disrupts membrane structures within the size range of exosomes, inducing T-EXO depletion and enhancing cancer immunotherapy[1].
Sequence d-{Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-NH2}
Shortening d-{SGSWLRDVWDWICTVLTDFKTWLQSKL-NH2}
Formula C154H228N38O40S
Molar Mass 3283.75
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Sol Shin, et al. Curvature-sensing peptide inhibits tumour-derived exosomes for enhanced cancer immunotherapy. Nat Mater. 2023 May;22(5):656-665.