| Bioactivity | AH-D peptide is an antiviral peptide that selectively disrupts membrane structures within the size range of exosomes, inducing T-EXO depletion and enhancing cancer immunotherapy[1]. |
| Sequence | d-{Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-NH2} |
| Shortening | d-{SGSWLRDVWDWICTVLTDFKTWLQSKL-NH2} |
| Formula | C154H228N38O40S |
| Molar Mass | 3283.75 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Sol Shin, et al. Curvature-sensing peptide inhibits tumour-derived exosomes for enhanced cancer immunotherapy. Nat Mater. 2023 May;22(5):656-665. |