| Bioactivity | ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1]. |
| Name | ACTH (7-38) (human) |
| CAS | 68563-24-6 |
| Sequence | Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu |
| Shortening | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLQ |
| Formula | C167H257N47O46 |
| Molar Mass | 3659.11 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Verma PS, et.al. Inhibition of canine lung angiotensin converting enzyme by ACTH and structurally related peptides. Biochem Biophys Res Commun. 1982 Feb 26;104(4):1484-8. |
ACTH (7-38) (human)
CAS: 68563-24-6 F: C167H257N47O46 W: 3659.11
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory pe
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.