| Bioactivity | A8SGLP-1 TFA is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 TFA reduces blood glucose in db/db mice without affecting its function[1]. |
| Name | A8SGLP-1 TFA |
| Sequence | His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-NH2 |
| Shortening | HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 |
| Formula | C151H229N41O47.xC2HF3O2 |
| Molar Mass | 3370.68 (free acid) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hanlin Zhang, et al. Oral glucagon-like peptide 1 analogue ameliorates glucose intolerance in db/db mice. Biotechnol Lett. 2022 Oct;44(10):1149-1162. |