PeptideDB

5-TAMRA-Amyloid β-Protein (1-40)

CAS: 1802087-81-5 F: C219H315N55O62S W: 4742.24

5-TAMRA-Amyloid β-Protein (1-40) is a fluorescent (TAMRA)-labeled Amyloid β-Protein (1-40), Abs/Em=544/572 nm.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity 5-TAMRA-Amyloid β-Protein (1-40) is a fluorescent (TAMRA)-labeled Amyloid β-Protein (1-40), Abs/Em=544/572 nm[1].
Target others
Name 5-TAMRA-Amyloid β-Protein (1-40)
CAS 1802087-81-5
Sequence {5-TAMRA-Asp}-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Shortening {5-TAMRA}-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Formula C219H315N55O62S
Molar Mass 4742.24
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Jakob Domert, et al. Spreading of amyloid-β peptides via neuritic cell-to-cell transfer is dependent on insufficient cellular clearance. Neurobiol Dis. 2014 May:65:82-92.