Bioactivity | 5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). 5-FAM-LL-37 TFA is a LL-37 peptide labeled with fluorescein, which retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to the bacterial cell membrane, destroys the integrity of the membrane, and exhibits board-spectrum antibacterial efficacy[1]. | ||||||
Sequence | {Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser | ||||||
Shortening | {Fluorescein-5-carbonyl}[LL-37, 37 aa] | ||||||
Formula | C226H350N60O59.xC2HF3O2 | ||||||
Molar Mass | 4851.56 (free acid) | ||||||
Appearance | 固体 | ||||||
Transport | Room temperature in continental US; may vary elsewhere. | ||||||
Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
Reference | [1]. Pastuszak K, et al., Insight into the Mechanism of Interactions between the LL-37 Peptide and Model Membranes of Legionella gormanii Bacteria. Int J Mol Sci. 2023 Jul 27;24(15):12039. |