PeptideDB

5-FAM-Ahx-LL-37 TFA

CAS: F: C232H361N61O60.xC2HF3O2 W: 4964.72 (free acid)

5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity 5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via a 6-carbon spacer, 6-Aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity[1].
Sequence {5-FAM-Ahx}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Shortening {5-FAM-Ahx}[LL-37, 37 aa]
Formula C232H361N61O60.xC2HF3O2
Molar Mass 4964.72 (free acid)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)