| Bioactivity | 3X HA Tag is a biological active peptide. (This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.) |
| Name | 3X HA Tag |
| Sequence | Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu |
| Shortening | MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE |
| Formula | C205H272N38O67S |
| Molar Mass | 4372.63 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |