| Bioactivity | (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand[1]. |
| Name | (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) |
| CAS | 213779-11-4 |
| Sequence | Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr |
| Shortening | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY |
| Formula | C194H303N59O53 |
| Molar Mass | 4309.85 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hoare SR, et al. Evaluating the ligand specificity of zebrafish parathyroid hormone (PTH) receptors: comparison of PTH, PTH-related protein, and tuberoinfundibular peptide of 39 residues. Endocrinology. 2000 Sep;141(9):3080-6. |
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS: 213779-11-4 F: C194H303N59O53 W: 4309.85
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) recep
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.