| Bioactivity | (Tyr0)-Urocortin, rat is a high-affinity agonist of corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (CRF-R2). (Tyr0)-Urocortin, rat shows inhibitory binding constants (Ki) of 1-2 nM[1]. |
| Name | (Tyr0)-Urocortin, rat |
| CAS | 187111-93-9 |
| Shortening | YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 |
| Formula | C215H347N63O66 |
| Molar Mass | 4870.50 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
(Tyr0)-Urocortin, rat
CAS: 187111-93-9 F: C215H347N63O66 W: 4870.50
(Tyr0)-Urocortin, rat is a high-affinity agonist of corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.