| Bioactivity | (TYR34)-PTH (7-34) AMIDE (BOVINE) is a peptide derivative of Parathyroid Hormone (PTH)[1]. |
| Name | (TYR34)-PTH (7-34) AMIDE (BOVINE) |
| CAS | 86292-93-5 |
| Sequence | Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Tyr-NH2 |
| Shortening | FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 |
| Formula | C156H244N48O40S2 |
| Molar Mass | 3496.03 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. R L Shew, Inhibitory effect of [Tyr34]bPTH-(7-34)-amide on bPTH-(1-34) ability to reduce uterine contraction. Pharmacology. 1989;39(6):390-6. |