| Bioactivity | (Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion[1]. |
| Name | (Ser8)-GLP-1 (7-36) amide, human |
| CAS | 215777-46-1 |
| Shortening | HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Formula | C149H226N40O46 |
| Molar Mass | 3313.63 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |