PeptideDB

(Ser8)-GLP-1 (7-36) amide, human

CAS: 215777-46-1 F: C149H226N40O46 W: 3313.63

(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity (Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion[1].
Name (Ser8)-GLP-1 (7-36) amide, human
CAS 215777-46-1
Shortening HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Formula C149H226N40O46
Molar Mass 3313.63
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.