| Bioactivity | (Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with Ki/ Kd value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes[1][2]. | ||||||
| Name | (Pro3) GIP, human TFA | ||||||
| Sequence | Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln | ||||||
| Shortening | YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | ||||||
| Formula | C226H338N60O64S.xC2HF3O2 | ||||||
| Molar Mass | 4951.53 (free base) | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
||||||
| Reference | [1]. Victor A Gault, et al. Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3)GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes. Diabetes. 2005, 54, 8. [2]. A H Sparre-Ulrich, et al. Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br J Pharmacol. 2016, 173, 1. |
(Pro3) GIP, human TFA
CAS: F: C226H338N60O64S.xC2HF3O2 W: 4951.53 (free base)
(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, huma
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.