| Bioactivity | (Nle35)-Amyloid β-Protein (1-42) ammonium is a peptide. |
| Name | (Nle35)-Amyloid β-Protein (1-42) (ammonium) |
| Shortening | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-{Nle}-VGGVVIA (ammonium) |
| Formula | C204H316N56O60 |
| Molar Mass | 4513.03 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bitan G, et al. A molecular switch in amyloid assembly: Met35 and amyloid beta-protein oligomerization. J Am Chem Soc. 2003 Dec 17;125(50):15359-65. [2]. Lazo, N. D., et al. On the nucleation of amyloid β-protein monomer folding. Protein Science, 2009, 14(6), 1581–1596. |