| Bioactivity | (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a biologically active peptide. |
| Name | (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) |
| CAS | 181057-31-8 |
| Sequence | Ala-Val-Ser-Glu-Ile-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Trp-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr |
| Shortening | AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY |
| Formula | C196H308N58O53 |
| Molar Mass | 4324.90 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS: 181057-31-8 F: C196H308N58O53 W: 4324.90
(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a biologically active peptide.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.