Bioactivity | (Gly22)-amyloid beta-protein(1-40) (Arctic variant Ab40ARC (E22G)) is a peptide. (Gly22)-amyloid beta-protein(1-40) can be used for the research of Alzheimer's disease[1]. |
Name | (Gly22)-amyloid beta-protein(1-40) |
CAS | 175010-18-1 |
Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
Shortening | DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV |
Formula | C191H291N53O56S |
Molar Mass | 4257.74 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. Lashuel HA, et al. Mixtures of wild-type and a pathogenic (E22G) form of Abeta40 in vitro accumulate protofibrils, including amyloid pores. J Mol Biol. 2003 Sep 26;332(4):795-808. |